#API
#MVC
#ORM
#PPC
#Permjob
#SEO
#SaaS
#content
#contentstrategy
#css
#devops #engineer #cloud #aws
#digitalmarketing
#eCommerce
#fullstackC#
#googleadwords
#html
#javascript
#mobileappdevelopment
#react
#reactjs
#reactnative
#remote
#startups
#webdevelopment
.NET
.Net
.js
.net
.net core
.net-core
2d-games
3d
A/B Testing
AKKA
APAC
APAC-timezone
API
API Development
AR
AWS
Absinthe
Account Executive
Account Management
Accounting
Admin
Advocate
Affiliate
Agency
Agile
Airflow
Algorithms and Data Structure
Amazon RDS
Analyst
Analytics
Android
Android App
Angular
Apollo
App Development
Augmented Reality
Aurora MySQL
Automation
Automation tool
BSc
BUS dev
Backend
Bash
Big Data
Bitcoin
Blockchain
Blogger
Bootstrap
Business
C
C#
C# .NET
C++
CASSANDRA
CI/CD
CNode
CRM
CRO
CSM
CSS
Cassandra
Celery
Chef
Cloud
Cloud Development
Cloud Foundry
Communications
Community
Community Manager
Computer Science
Content
Conversion optimization
Cookies
Coordinator
Counseling
Creative Design
Crypto
Css
Curriculum
Customer Success
Customer Support
Customer Support Manager
Customer service
Cyber security
Cycling
DEVOPS
DNS
DOM
Dagger
Dashboard
Data
Dating
Design
Dev
DevOps
DevSecOps
Developer
Developing
Digital Analyst
Digital Media
Distributed Systems
Django
Docker
Doctrine
E-Learning
E-Mail Marketing
ES6
Edtech
Electron
Elixir
EmberJS
Engineer
English
Erlang VM
Es6
Evangelist
Exchange
Exec
FB Ads
Flask
Flow
Front End
Front end
Front-End
Fronted
Frontend
Full Stack
Full stack
Full-stack
Fullstack
GCE
GCP
GO
Game design
Gaming
GeekPickUpLines
Git
Go
Golang
Good fun
Google Cloud
Google Cloud Platform
Governance
GraphQL
Growth
Grwoth
HR
HTML
Healtcare Tech
Healthcare
Html
IDEA
IOS
Influencer
Influencer Marketing
Infrastructure-as-code
Instagram Ads
Intercom
International
Internet of Things
J2ee
JAMSTACK
JAVASCRIPT
JDK
JIRA
JS
Jasmine
Java
JavaScript
Javascript
Javascript dApp code
Jenkins
Jest
JsAppium
KAFKA
KANBAN
Kafka
Keras
Kotlin
Kraken
Kubernetes
L2
LAMP
Lambda
Laravel
Lead
Linux
Livestreaming
MHA
MSc
Machine Learning
Management
Manager
MariaDB
Marketing
Mathematics
Mentor
Mesos
Meteor JS
Micro Frontend
Microservices
Microsoft Fakes
Mob
Mobile
Mobile Development
MongoDB
MySQL
MySQL DBA
MySQL Support Engineer
NET
NODE
Network Security
Nextjs
No Legacy Code
Node
Node.js
Node.js & React.js
NodeJS
Nodejs
Non-profit
Numpy
Nunit
OOP
Onboarding & Adoption
Open Source
Operations
PHP
PPC
PR
PTK
Percona
Performance Marketing
Phoenix
Pmm
PostgreSQL
Postgres
Product
Product Design
Product Management
Product Marketer
Project Management
Protractor
Public Relations
Publishing
Python
QA
REACT
REST APIs
RabbitMQ
Rails
React
React Native
React.js
Recruiter
Redshift Engineer
Redux
Remote
Renewable energy
Retrofit
RoR
Robotics
Ruby
Ruby on Rails
Ruby on rails
RubyonRails
Rxjava
SAAS
SCALA
SDK's
SEM
SEO
SET
SITE RELIABILITY
SME
SPA
SQL
SRE
SaaS
Sales
Sales Development
Sales Management
Salesforce
Scala
Scipy
Scrum
Scrum Master
Security
Senior
Senior Drupal Developer
Serverless
SignalR
Site Reliability
Sklearn
Snowflake
Social Media
Social media
Software
Software Engineer
Software Testing
Software engineer
Solidity
Spark
Spring
Sr
Sr.
Startup
Startups
Support
Swift
Symfony
TDD
Team leader
Tech sales
Technical Product Design
Technical Support
Technical support
Technical writer
Technology
Teenagers
Terraform
Test Automation
Testing
Travel
TypeScript
Typescript
UI
UX
UX/UI
UX/UI Designer
Ubuntu
Unity
Unix
User Experience
User Interface
VC-funded
Video
Vue
VueJS
Web
Web Components
Web Dev
Web3
WebApps
WebAssembly
Wireless
WooCommerce
WordPress
Wordpress
Writer
Writing
Zendesk
a/b testing
ab-testing
abap
accessibility
account executive
account management
account manager
accounting
acquisition
act-on
active-directory
activemq
activiti
acumatica
add-in
admin
administrative
adobe
ads
advanced-custom-fields
adventure
advertising
aem
aem-6
affiliate
affiliate manager
affiliate marketing
after-effects
agency
agent
agile
agile-processes
agile-project-management
ai
airflow
ajax
akka
alamofire
algorithm
all professions welcome
alm
amazon
amazon-cloudformation
amazon-cloudfront
amazon-cognito
amazon-dynamodb
amazon-ec2
amazon-kinesis
amazon-kinesis-firehose
amazon-rds
amazon-redshift
amazon-s3
amazon-vpc
amazon-web-services
amd
amplitude
analyst
analytics
android
android-constraintlayout
android-studio
angular
angular 2
angular-fullstack
angular-material2
angular6
angularjs
ansible
apac
apache
apache-flink
apache-kafka
apache-spark
apache-spark-sql
apex
apex-code
api
api's
api-design
api-gateway
apigee
apis
apollo
app
appium
apple-watch
apps
aptible
archaeology
architect
architecture
arcore
arkit
artificial-intelligence
asia
asic
asp.net
asp.net-core
asp.net-core-mvc
asp.net-mvc
asp.net-web-api
asp.net-web-api2
assetmanagement
asynchronous
audio
augmented-reality
aurelia
aurora
auth0
authentication
autocad
autocad-plugin
autodesk
autolayout
automated testing
automated-testing
automated-tests
automation
autotools
aws
aws lambda
aws-lambda
aws-opsworks
aws-serverless
axure
azure
azure-active-directory
azure-cloud-services
azure-data-factory
azure-data-lake
azure-devops
azure-functions
azure-pipelines
azure-service-fabric
azure-sql-database
azure-web-sites
b-corp
b2b
b2c
babel
babeljs
back
back end
back-end
back-end engineering
backbone
backbone.js
backend
balsamiq
bash
bem
benchmarking
big data
bigdata
billing
bitbucket
bitcoin
blockchain
blueprism
bluetooth-lowenergy
bookkeeping
boost
bootstrap
bootstrap-framework
brand
brand manager
brightscript
browser
build
build-automation
bulma
burp
bus dev
business development
business-intelligence
c
c plus plus
c#
c#-4.0
c++
c++11
cakePHP
cakephp
calico
camunda
can
canopen
canvas-lms
capybara
cassandra
cd
cdn
celery
centos
ceph
cfc
charles-proxy
chef
cherrypy
chief
china
chromium
chromium-embedded
ci
ci/cd
cicd
circleci
civicrm
cleancode
client relations
client service
client-server
clojure
clojurescript
cloud
cloud native
cloudera
cloudformation
cloudfoundry
cloudfront
cmake
cms
cocoa
cocoa-touch
coffeescript
coldfusion
communications
community
community development
community management
compilation
compiler
computational-finance
computational-geometry
computer-forensics
computer-science
concurrency
configuration
configuration-management
conflict resolution
confluence
connect-iq
consensus
constraint-layout
consulting
containers
content
content creation
content editing
content editor
content-management-system
continuous-delivery
continuous-deployment
continuous-integration
conversion optimisation
copyrwiter
copywriter
copywriting
cordova
core
core-data
counselor
cqrs
craft cms
crawlera
creative
creative designer
crm
cro
cross-browser
cross-platform
crypto
cryptocurrency
cryptography
csharp
css
css in js
css3
cto
cucumber
cuda
custom-error-handling
customer
customer & community
customer advocate
customer experience
customer facing
customer service
customer success
customer support
cycling
cypress
d
d3.js
dapps
dashboard
data
data analysis
data analyst
data analytics
data engineering
data logging
data modeling
data pipelines
data science
data visualization
data viz
data-analysis
data-extraction
data-lake
data-migration
data-modeling
data-science
data-structures
data-visualization
data-warehouse
database
database-administration
database-performance
databricks
datadog
dating
dba
dbt
deal closure
debian
decentralized apps
demand generation
demandware
deployment
design
design & user experience
design-patterns
desktop-application
detail-oriented
detection
dev
dev advocate
dev tools
dev-ops
developer
developer advocate
development
devops
devrel
digital
digital brand
digital brand manager
digital marketing
digital media
digital nomad
digital ocean
digital-design
digital-ocean
dimensional-modeling
distributed
distributed systems
distributed-computing
distributed-system
dita
django
django-rest-framework
dkim
dns
docker
docker-compose
documentation
dom
domain-driven-design
donations
dot net
dotnet
dotnetnuke
dpdk
drone.io
drupal
drupal developer
drupal-7
drupal-8
drupal-modules
drupal8
drush
dutch
dynamics-ax-2009
dynamodb
e-Learning
e-commerce
e2e-testing
eCommerce
eclipse
ecmascript-2017
ecmascript-6
ecmascript-7
ecommerce
eda
editing
edtech
education
ee
elastic
elasticsearch
elasticsearch-5
electron
elixir
elk
elk-stack
elm
email marketing
embedded
embedded-linux
ember
ember.js
emv
encryption
engineer
engineering
english
english teacher
enterprise
enterprise-architect
entity-framework
entity-framework-core
entrepreneurship
erlang
erp
es6
esb
ethereum
ethernet
etl
event-driven
event-sourcing
events
excel
exec
executive
express
expressjs
extbase
extjs
f#
facebook
fb-ads
fido
filmmaking
finance
financial
fintech
firebase
firmware
flask
flask-restful
fluid
flutter
fpga
framework
frameworks
freeswitch
french
front end
front-end
front-end engineering
frontend
fs2
ftp
full stack
full stack designer
full time
full-stack
fullstack
functional programming
functional-programming
fxml
game dev
game developer
game development
game-engine
game-theory
garmin
gatsby
gcloud
gcp
gdpr
generalist
geolocation
geology
geospatial
german
ghc
gherkin
gin-gonic
gis
git
git (Bitbucket)
github
gitlab-ci
gke
glsl
gmail
go
go-gorm
golang
good vibes
google cloud platform
google-adwords
google-analytics
google-app-engine
google-cloud-platform
google-kubernetes-engine
google-maps
google-play
googletagmanager
gps
gpu
graalvm
gradle
grape
graph-databases
graphQL
graphic designer
graphql
grognard
groovy
growth
growth marketing
grpc
gui
gulp
hadoop
haml
hanami
hardware
haskell
haskell-stack
healthcare
healthtech
help desk
helpdesk
heroku
hibernate
high-availability
hipaa
hit
hive
hl7
hl7-fhir
hlsl
hosting
html
html/css
html5
html5-canvas
http
http4s
hubspot
hybrid
hybrid-mobile-app
hydrology
hyperledger
hyperv
iOS
iOS App
iOS Swift
iaas
iam
ide
iis
illustrator
image-processing
imap
immutable.js
implementation
inbound sales
indexeddb
influencer
influxdb
informatica
informatica-powercenter
information-retrieval
infosec
infrastructure
infrastructure-as-code
insights
instagram
instrumentation
integration
integration-testing
intel
intellij-idea
interface design
internship
interviewer
intrusion-detection
invision-power-board
ionic
ionic-framework
ionic-native
ionic3
ios
ios-autolayout
iot
ip-protocol
ipfs
iphone
ipsec
iso
iso8583
it
it manager
itil
j2ee
java
java-8
java-bytecode-asm
java-ee
java-script
javafx
javafx-8
javascript
javascriptcore
javescript
jboss
jdbc
jee
jenkins
jest
jestjs
jira
jmeter
jms
jpos
jquery
jruby
js
js/react
json
jsp
junior
junit
jupyter-lab
jupyter-notebook
jvm
kafka
kamailio
kanban
katana
kentico
keras
kibana
knative
knockout.js
knowledge-management
kotlin
kubernetes
l1
l2
l3
lambda
lamp
lan
language-server-protocol
laravel
laravel-4
laravel-5
latex
ldap
lead
leadership
leaflet
less
linear-algebra
linkedin
linux
linux-kernel
lisp
load-testing
local food
locust
lodash
logging
logistics
logstash
looker
lucene
macOS
machine images
machine learning
machine-learning
machinelearning
macos
magento
magento-2.0
magento2
magento2.2
make
malware
management
manager
manual testing
manual-testing
mariadb
markdown
marketing
marketing & sales
marketing analytics
marketo
master-data-management
material-design
material-ui
math
matlab
matplotlib
maven
maya
mdx
mean
mean-stack
medical
member services
memcached
mental health
mentor
mern
mesos
message-queue
meteor
meteor js
meter
micro-services
microservices
microsoft
microsoft-dynamics
microsoft-test-manager
microstrategy
mid
middleware
migration
miscellaneous
mission driven
mobile
mobx
mobx-react
mockito
mockups
model-view-controller
mom
mongo
mongoDB
mongodb
mongoid
monitoring
monkey-c
monkeyc
monkeypatching
moya
mq
ms-access
ms-office
mssqlserver
msvc
msys2
multithreading
munin
music
mvc
my-sql
mybatis
mysql
native english
neo4j
net
netsuite
network security
network-programming
networking
new relic
newrelic
next.js
nginx
nlp
node
node js
node.js
nodejs
nomad
non tech
non-profit
non-tech
nonprofit
nontech
nosql
npm
ntp
nuke
numpy
nuxt.js
oauth
oauth-2.0
objective c
objective c code
objective-c
objective-c-swift-bridge
observability
ocaml
odata
odbc
odoo
office administrator
office manager
offline
okhttp
okta
olap
onboarding
online
ooad
oop
open source
open-source
openapi
opencv
openjdk
openshift
opensource
openstack
openvswitch
operating systems
operations
ops
optimization
oracle
oracle11g
orm
ossec
otp
outdoor
outdoors
p2p
p5.js
paas
pache
packer
pagerduty
panda3d
pandas
part time
part-time
partnership management
partnership marketing
password-less
payment
paypal
pcfdev
pci
penetration-testing
pentaho
peoplecode
performance
performance-testing
perl
phaser-framework
phoenix
phoenix-framework
photoshop
php
php-7
phpunit
pixi.js
pjsip
platform
play store
playframework-2.0
polymer-2.x
postgis
postgres
postgresql
postgrest
postman
powerbi
powershell
pr
preact
presto
pricing
prioritizing
privacy-policy
process improvement
processing
product
product design
product development
product management
product manager
product marketing
product owner
product support
product-management
production
profiling
program management
progressive-web-apps
project management
project manager
project-management
prometheus
protocol-buffers
protocols
protractor
proxy
public relations
puppet
puppeteer
pyspark
python
python-2.x
python-3.x
pytorch
qa
qlikview
qml
qt
quality
quality assurance
r
rabbitmq
rails
ramda.js
rancher
raspberry-pi
rds
react
react native
react-apollo
react-fullstack
react-native
react-native-android
react-native-ios
react-redux
react-router
react.js
reactive-programming
reactiveui
reactivex
reactjs
reactnative
realm
recruitment
recruitment operations
redfahren
redhat
redigieren
redis
redshift
redux
redux-saga
refactoring
referential-transparency
referral
regex
relational-database
release-management
remote
remote work
rendering
renewable
reporting-services
research
researching
responsive
responsive webpage development
responsive-design
rest
rest-api
restful
restful api's
restful-architecture
restful-authentication
reswift
retrofit
revit
revit-api
robotics
rocksdb
roku
rollbar
ror
route53
routing
rpa
rspec
rtos
ruby
ruby on rails
ruby-on-rails
ruby-on-rails-3
ruby-on-rails-4
ruby-on-rails-5
rubygems
rubyonrails
rust
rx-java
rx-kotlin
rx-swift
rxjava
rxjs
s
s3
saas
saga
sales
sales force
salesforce
salesforce-lightning
salt
salt-stack
saml
saml-2.0
sap
sapui5
sass
scala
scala-cats
scalability
schreiben
scientist
scipy
scrapy
scripting
scrum
scss
sdk
sdlc
se
search
securitiy
security
selenium
selenium-webdriver
sem
senior
senior developer
sensu
seo
server
serverless
serverless-framework
servicenow
sftp
sgx
sha
shell
shiny
shopify
sidekiq
signal-processing
single-page-application
sip
sitecore
sitefinity
sketch
sketchapp
slack
slate
small company
smarty3
smb
sme
smtp
snowflake
snowplow
soa
soap
soc
social media
socket.io
software
software development
software engineer
software sales
software support
software testing
software-engineering
software-quality
solidity
solidus
solr
soql
soshace
spanish
spark
specifications
speech
sports
spree
spring
spring-boot
spring-cloud
spring-data-jpa
spring-mvc
springboot
sprint
spss
sql
sql-server
sqlalchemy
sr.
sre
ssas
ssh
ssl
stack-overflow
stakeholder management
start up
startup
static-analysis
static-typing
statistics
stats
stored-procedures
storybook
streaming
stress-testing
stripe-payments
styled-components
sugarcrm
suitecloud
suitecommerce
supervised-learning
supplemental income
support
support manager
swift
swiftype
swing
swingx
symfony
symfony2
sys admin
sysadmin
system
system administration
system-testing
systems engineering
tableau
talent
tax
tcp
tcpdump
tdd
teaching
tealium
team lead
team leader
team manager
team player
teamcity
tech
tech support
technical
technical support
technical writing
technical-interviewing
telecommuting
tensorflow
teramind
terraform
terraform-provider-aws
test
test automation
test frameworks
test-driven-development
tester
testing
tfsbuild
themes
three.js
todoist
tomcat
tools qa
transportation
travel
troubleshooting
truffle
trust-zone
trusted-computing
tsql
twig
twist
twitter-bootstrap
typescript
typo3
typoscript
ubuntu
udeploy
ui
ui-design
ui-testing
ui/ux
uikit
uipath
umbraco
uml
unit-testing
unity
unity 3d
unity3d
unix
unsupervised-learning
upgrade
usability
user experience
user research
user-experience
user-interface
ux
ux design
varnish
vb6
vba
vbscript
vfx
vhdl
vice president
video
view-debugging
viral
virtual reality
virtual-machine
virtualbox
virtualization
visual-studio
visual-studio-2017
visual-studio-2019
visualforce
visualization
vm
vmware
voice
voip
vpn
vr
vue
vue react angular
vue.js
vuejs2
vuex
vuforia
wallet
wan
wandern
watch-os
watchkit
watchos
wearables
web
web dev
web development
web hosting
web technologies
web-accessibility
web-applications
web-crawler
web-development-server
web-scraping
web-services
web-technologies
webgl
weblogic
webpack
webrtc
website design
websocket
websphere
windows
windows-server
windowsserver
winforms
wireframe
wix
wlan
woocommerce
wordpress
wordpress-plugin
wordpress-rest-api
wordpress-theming
work from home
workflow
wp-cli
wpf
writer
writering
writing
x++
xamarin
xamarin.forms
xaml
xcode
xml
xtrabackup
yarn
yii
yocto
young adults
zend-framework
zendesk
zeromq
😹

Jobs

all over the world

Technical Co-Founder / Head of Engineering

Trellis Technologies

node.jsreactjsjavascriptexecengineer
2 days ago
I want it

Senior Android Developer

1 Second Everyday

JavaAndroidgitrxjavajunitmockito
2 days ago
I want it

iOS Developer

1 Second Everyday

swiftreswiftgitios
2 days ago
I want it

QA Analyst

Lasso Data Systems Inc

qatestingautomated-testsseleniumautomationanalystquality assurance
2 days ago
I want it

Senior Software Developer

Railroad19

reactjsjavascriptnode.jshtml5devseniordigital nomad
2 days ago
I want it

Software Development Engineer in Test

Wallethub

javaseleniumautomated-testsautomation
3 days ago
I want it

Senior Java Developer - Remote

Wallethub

javaspringmysql
3 days ago
I want it

Senior Technical Account Manager

Radix DLT

sysadminexecsenior
3 days ago
I want it

Remote Full-Stack JS Developer

Obby

javascriptnodegood vibes😹
3 days ago
I want it

Full-stack Developer with React and Django

Soshace

reactjsnode.jscsshtmljavascript
3 days ago
I want it

Front-end developer with React or Angular2+

Soshace

reactjsjavascriptnode.jsfrontendangular
3 days ago
I want it

Backend Software Developer - Java

Fidectus

back-end engineering
3 days ago
I want it

Senior Frontend Software Developer

Fidectus

front-end engineering
3 days ago
I want it

Software Engineer

Invitae

pythonjavascriptscaladjangoreactdevengineerdigital nomad
3 days ago
I want it

Senior Front-End Developer

Inboxlab

front-end engineering
3 days ago
I want it

Lead Back-End Engineer

Inboxlab

back-end engineering
3 days ago
I want it

Director of UI/UX

ThreatConnect

user-experienceuser-interfacereactjsjavascriptapidesignexecdigital nomad
4 days ago
I want it

iOS Developer

1 Second Everyday

iosobjective-cswiftdevdigital nomad
4 days ago
I want it

Software Engineer <progressive ed nonprofit>

Achievement Network

javaangulargojavascriptmysqldevengineerdigital nomad
4 days ago
I want it

DevOps Engineer - REMOTE

SemanticBits

hadoopamazon-web-servicesapache-sparkdevopsengineer
4 days ago
I want it

Senior Full-Stack JavaScript Developer

Scalable Path

javascriptnode.jsgofull stackdevseniordigital nomad
4 days ago
I want it

Customer Care Support

Daiwa House Group(DHG)

Original
Remotecustomer support
4 days ago
I want it

Senior Performance Engineer

Pitch

performancefrontendreact
4 days ago
I want it

DevOps Engineer

ReCharge Payments

pythondockeransibleclouddevopsengineer
4 days ago
I want it

Senior Frontend Engineer - Clojure/Script

Pitch

clojureclojurescriptdev
4 days ago
I want it

Full Stack Developer

ChangeX

RubyrailsJavascripthtmlcss
4 days ago
I want it

Javascript Engineer

1 other job Sticker Mule

javascriptengineer
4 days ago
I want it

Javascript Engineer

Sticker Mule

JavaScriptEngineer
4 days ago
I want it

Software Engineer, Vagrant

HashiCorp

rubyvmvirtualizationwindowsvmwarevirtualboxdockerhypervdev tools
4 days ago
I want it

Software Engineer, Packer

HashiCorp

gogolangpackercloudvmvirtualizationmachine imagesinfrastructurecdci
4 days ago
I want it

Paid Research Study for Developers who use Visual Studio

User Research International

visual-studiovisual-studio-2017visual-studio-2019
4 days ago
I want it

Senior Rails Engineer MyTime Series B SaaS Startup

Source Coders Inc

ruby-on-railspostgresqlrubyelixiramazon-web-services
5 days ago
I want it

Publisher Support Engineer

Mediavine

sqlftpengineer
5 days ago
I want it

Full Stack Web Developer

SOCi

Full StackLAMPSaaSMobSr.Remote
5 days ago
I want it

Cloud Security Engineer

Zapier

amazon-web-serviceskuberneteslinuxpythoninfoseccloudengineer
5 days ago
I want it

Application Security Engineer

Zapier

pythondjangographqlnode.jsinfosecengineer
5 days ago
I want it

Senior PHP Developer

Rebilly

devphpseniordigital nomad
5 days ago
I want it

Senior PHP Developer

Rebilly

PHPDeveloperSenior
5 days ago
I want it

Sr. Scala Engineer

Blue Orange Digital

scalaakkaengineer
5 days ago
I want it

Full Stack Web Developer

SOCi

lampfull stackdevweb devdigital nomad
5 days ago
I want it

Dev Ops Engineer

SOCi

devopsawskubernetesengineer
5 days ago
I want it

Data Engineer

Catch Co.

data engineering
5 days ago
I want it

Salesforce Developer

Xapo

salesforcedevopsdevdigital nomad
5 days ago
I want it

Site Reliability Engineer

Balena

amazon-web-serviceslinuxsys adminengineer
5 days ago
I want it

Build Pipeline Engineer

Balena

linuxproject-managementnode.jsengineer
5 days ago
I want it

Experienced Java Web Developer

O'Reilly Auto Parts

javasqljquerytwitter-bootstrapweb-services
5 days ago
I want it

Senior Compiler Engineer

Luna

javascalatrufflejvmgraalvmseniorengineer
5 days ago
I want it

Senior macOS Engineer

DuckDuckGo

macosswiftseniorengineer
5 days ago
I want it

Lead Developer

Labster

djangopythonagiledevexecdigital nomad
5 days ago
I want it

Senior Frontend Engineer

DuckDuckGo

javascriptfront endseniorengineer
5 days ago
I want it

Senior Web Developer

Authority Partners

javascriptc#vue.jsdevweb devseniordigital nomad
5 days ago
I want it

Senior Compiler Engineer

Luna

javascalatrufflejvmgraalvmseniorengineer
5 days ago
I want it

Senior Golang Engineer

Liveforce

golangseniorgolangengineer
5 days ago
I want it

Backend Developer

Toggl

golangdevbackenddigital nomad
5 days ago
I want it

Senior Rails Software Engineer

GateMedia SA

ruby-on-railsgithubgitherokugraphql
5 days ago
I want it

IT System Engineer

Infineon

linuxunixwindows.netenterprise-architect
5 days ago
I want it

Content Manager

Doubledot Media

content creationcopywritingexec
5 days ago
I want it

Technical Product Manager

Redox

continuous-integrationamazon-web-servicestypescriptnode.jsproduct managerexec
5 days ago
I want it

Senior .NET Devloper

at

asp.netreactjsangularjssql.netsenior
5 days ago
I want it

Software Engineer

TaxJar

acumaticac#.netsql-serverdevengineerdigital nomad
5 days ago
I want it

Software Tester

Art+Logic

miscellaneous
5 days ago
I want it

Senior Full Stack Software Engineer - Enablement Team

Auth0

reactjsnode.jsweb-servicesreactmongodb
6 days ago
I want it

Agile Business Analyst

A-Line Staffing Solutions

sysadminanalyst
6 days ago
I want it

Senior Backend Developer

gomo video

javapostgresqlspringamazon-web-servicesdevseniorbackenddigital nomad
6 days ago
I want it

Full stack web developer, remote, UK only

ClearLife Limited

c#sqljavascriptasp.netasp.net-web-api2full stackdevweb devdigital nomad
6 days ago
I want it

Senior Full Stack Engineer

FormAssembly inc

javascriptsaasfull stackseniorengineer
6 days ago
I want it

Front-End Developer

Chili Piper

ReactjavascripttypescriptkubernetesGoogle Cloud PlatformREST APIs
6 days ago
I want it

Web QA Specialist

ShotFlow

QA
6 days ago
I want it

Senior Cryptography Engineer

Fetch.AI

c++pythonccryptographyseniorengineer
6 days ago
I want it

Software Engineer

Wikimedia Foundation

phpjavascriptcss
6 days ago
I want it

Javascript Developer - Backend or Frontend

Tribe Labs

javascriptnodejsreactfrontendfullstack
6 days ago
I want it

Windows / UWP Engineer

Sherpany AG

windowsmobileiosengineer
6 days ago
I want it

Elixir/API Engineer with Growing Messaging Company

ProKeep

elixirgraphqlpostgresqlphoenixapiengineer
6 days ago
I want it

Lead DevOps Engineer

Prominent Edge

DevOps
7 days ago
I want it

We're looking for a Senior PHP Developer for our SaaS Event Ticketing Platform

Softab

phplaravelsaasdevseniordigital nomad
7 days ago
I want it

.Net Developer [REMOTE]

Clevertech

nosqlc#.netsqlasp.net
7 days ago
I want it

React Native Mobile Developer [REMOTE]

Clevertech

reactjsmobilereact-nativeiosandroid
7 days ago
I want it

Senior Full Stack Developer, Node/React [REMOTE]

Clevertech

javascriptreactjsnode.jssqlredux
7 days ago
I want it

React Developer [REMOTE]

Clevertech

reactreduxjavascriptreactjsreact-redux
7 days ago
I want it

Software Engineer II - Mill Toolpaths

CNC Software

c++c#algorithmlinear-algebracomputational-geometrydevengineerdigital nomad
7 days ago
I want it

Software Engineer

HubTran

devengineerdigital nomad
7 days ago
I want it

Remote Software Engineer

HubTran

EngineerSoftware
7 days ago
I want it

Senior Java Developer, Insurance Solutions [REMOTE]

Clevertech

javaoraclehibernaterestjava-ee
7 days ago
I want it

Tech Lead [REMOTE]

Clevertech

leadjavascriptarchitecturepython
7 days ago
I want it

Test Automation Engineer, Java [REMOTE]

Clevertech

javaseleniummavenautomated-teststesting
7 days ago
I want it

Full-stack Software Engineer

Fraym

Full-stackDjangoRuby on railsWordpressUIAngular
7 days ago
I want it

JavaScript Developer

Fetch.AI

reactjsjavascripthtml5css3
7 days ago
I want it

Backend Engineer

Impala

javascriptpostgresqlmongodbelasticsearchengineerbackend
7 days ago
I want it

Technical Solution Lead

BlueModus

.netc#asp.net-mvcjavascriptazure-devopsexec
9 days ago
I want it

QA Specialist

Xapo

testingautomated-testsjiraquality assurance
10 days ago
I want it

DevOps Engineer

TaxJar

amazon-web-servicesherokurubychefpuppetdevopsengineer
10 days ago
I want it

Front End Developer | create 'DevOps for AI' platform & tools | 100% remote

Dotscience

javascriptreactjsreduxfront enddevdevopsdigital nomad
10 days ago
I want it

Software Engineer | create 'DevOps for AI' platform & tools | 100% remote

Dotscience

gonode.jspythondockerdevdevopsengineerdigital nomad
10 days ago
I want it

Senior Java Developer - Remote

Wallethub

javaspringmysql
10 days ago
I want it

Senior Data Scientist- Remote, Global

Wallethub

machine-learningrjavapython
10 days ago
I want it